PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g06670.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 767aa    MW: 81340.2 Da    PI: 9.8876
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g06670.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.7e-40296372177
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   +CqvegC++ l+ akeyhrrhkvCe+hskap v+v g eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++
  Zjn_sc00004.1.g06670.1.am.mk 296 RCQVEGCHVLLAGAKEYHRRHKVCEAHSKAPRVVVLGAEQRFCQQCSRFHALSEFDDAKRSCRRRLAGHNERRRKSS 372
                                   6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33290358IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.505294371IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.14E-37295374IPR004333Transcription factor, SBP-box
PfamPF031101.4E-31297370IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MYSVRSTVHG RRVHVLYSTQ HQLQRQRQRT AGNCAGSSQN RGLRTAYPLL PNAQHGDPIS  60
PKARTYSPFP SQSDMGRAVA DTDDWTGPYA LRQARTLRPC TPGLLPRAGF PASGSSVPCV  120
MTGGSESRQT VALLLSGGLA RLPACLPACF LCGEPRRVNL PPYLQQQHQT PPLFRLCLPR  180
RRQEAMEGNG GGSGTATPSW DLGMHWAPAG SSGYPQPFAP QLGGGPSRDQ QQHQQEQTWL  240
NLGKQPCCWA GAGGSQQAPQ LSSWGHVHGN GGGTGGGSGA AAAAEGKRKE KAAAPRCQVE  300
GCHVLLAGAK EYHRRHKVCE AHSKAPRVVV LGAEQRFCQQ CSRFHALSEF DDAKRSCRRR  360
LAGHNERRRK SSASETMART VGHPHGLMPF GHGFFPSSPA GALSLLSSAR GGGAPWLIPA  420
TADISARSSA ALDELIAENR RALLAWQFFS DHSPAGRLVP SSSTGRVLPA GEVPAGWHTA  480
QIQDHPGGGA GRADDRYSFS EAPAGAGHTT LDLMQTPDTS AGAPFLQPVS ERAGSARTPR  540
KDGSDAGCTS VDAWASAEGA PDRVLQSRRR HGRRPSQTNS GARLITVPTC RSELWDGGAS  600
YVSPRSAMMA IMASPMRGSA IGFGKCGPYV VCKESHKRET TYAAMASPCA FRFVALIAVM  660
SILSLLAFPA SCHEDPAAEV TDESRQNTTT RRQAWAAAAR GYGGWSYGGA TWYGSPYGAG  720
GDAIFTSDQG GRKPSSDPLP LLWAAMGQFS SRAVEAAARV PVEPGRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-292973701184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0546549e-95BT054654.2 Zea mays full-length cDNA clone ZM_BFb0036O05 mRNA, complete cds.
GenBankEU9646569e-95EU964656.1 Zea mays clone 280651 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ7XT421e-104SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.18e-35squamosa promoter binding protein-like 3